.
The Open Protein Structure Annotation Network
PDB Keyword
.

2atz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein HP0184 from Helicobacter pylori. To be Published
    Site MCSG
    PDB Id 2atz Target Id APC5779
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS4823,NP_206983.1, 85962 Molecular Weight 21207.46 Da.
    Residues 180 Isoelectric Point 9.30
    Sequence mtemelklikidtshyfekkpglgervdyagrcfynkfqrvnamltssliqkhlkreieiahnlilrnd kvenivfdyngrnperfyhkaqlllreegfmnftayntktpghlhlyvhkghtelgegerlvktlsmkl aqglpkewkvfpsnewpkefnilalpyevfakergsswakhl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.25567
    Matthews' coefficent 2.40 Rfactor 0.19789
    Waters 100 Solvent Content 48.10

    Ligand Information
    Ligands DGT (2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE) x 1;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2atz
    1. Searching distant homologs of the regulatory ACT domain in phenylalanine hydroxylase
    J Siltberg-Liberles, A Martinez - Amino acids, 2009 - Springer
     
    2. Assisted assignment of ligands corresponding to unknown electron density
    TA Binkowski, M Cuff, B Nocek, C Chang - Journal of structural and , 2010 - Springer
     
    3. Structural Analysis of Hypothetical Proteins from Helicobacter pylori: An Approach to Estimate Functions of Unknown or Hypothetical Proteins
    SJ Park, WS Son, BJ Lee - International Journal of Molecular Sciences, 2012 - mdpi.com
     
    4. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch