.
The Open Protein Structure Annotation Network
PDB Keyword
.

2au5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved domain from locus EF2947 from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 2au5 Target Id APC29576
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5462,AAO82635, 226185 Molecular Weight 15705.00 Da.
    Residues 136 Isoelectric Point 4.33
    Sequence mlilstekepnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaaggmqgvivqs lledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftflllcsdefimyldsqpkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.28877
    Matthews' coefficent 2.10 Rfactor 0.19834
    Waters 124 Solvent Content 40.80

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch