.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aua

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of BC2332: A hypothetical protein from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 2aua Target Id APC25892
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5339,AAP09296, 226900 Molecular Weight 23528.52 Da.
    Residues 200 Isoelectric Point 5.54
    Sequence mnetefyayhivtrkkmhigqmipfnknqhntlyhfffereqlnangedgiqilnnhykndelhinnen akvvisymdqtiraaretivemvrlqefpeypsrlsclyaaksyedalkwkalfdsynrevlqivklrv igssfegdgnllpkedgipfsqkieqarkywkgnirnelpellingeievveiiddfssihi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.25388
    Matthews' coefficent 3.00 Rfactor 0.2038
    Waters 147 Solvent Content 58.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2aua
    1. 1,000 structures and more from the MCSG
    D Lee, TAP de Beer, RA Laskowski - BMC structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch