.
The Open Protein Structure Annotation Network
PDB Keyword
.

2az4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.0 A crystal structure of a hypothetical protein from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 2az4 Target Id APC29563
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5461,AAO82592, 226185 Molecular Weight 48970.21 Da.
    Residues 429 Isoelectric Point 4.94
    Sequence meskakttvtfhsgiltiggtvievaykdahiffdfgtefrpeldlpddhietlinnrlvpelkdlydp rlgyeyhgaedkdyqhtavflshahldhsrminyldpavplytlketkmilnslnrkgdflipspfeek nftremiglnkndvikvgeisveivpvdhdaygasallirtpdhfitytgdlrlhghnreetlafceka khtellmmegvsisfperepdpaqiavvseedlvqhlvrlelenpnrqitfngypanverfakiieksp rtvvleanmaalllevfgievryyyaesgkipelnpaleipydtllkdktdylwqvvnqfdnlqegsly ihsdaqplgdfdpqyrvfldllakkditfvrlacsghaipedldkiialiepqvlvpihtlkpeklenp ygerilpergeqivl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24423
    Matthews' coefficent 2.36 Rfactor 0.19788
    Waters 537 Solvent Content 47.00

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2az4
    1. Evaluation of features for catalytic residue prediction in novel folds
    E Youn, B Peters, P Radivojac, SD Mooney - Protein science, 2007 - Wiley Online Library
     
    2. Crystal structure of TTHA0252 from Thermus thermophilus HB8, a RNA degradation protein of the metallo-_-lactamase superfamily
    H Ishikawa, N Nakagawa, S Kuramitsu - Journal of , 2006 - Jpn Biochemical Soc
     
    3. A histidine in the [beta]-CASP domain of Artemis is critical for its full in vitro and in vivo functions
    JP De Villartay, N Shimazaki, JB Charbonnier - DNA repair, 2009 - Elsevier
     
    4. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    5. Structure and Activity of a Novel Archaeal [beta]-CASP Protein with N-Terminal KH Domains
    APG Silva, M Chechik, RT Byrne, DG Waterman, CL Ng - Structure, 2011 - Elsevier
     
    6. The Metallo-_-Lactamase Family of Ribonucleases
    C Condon, L Gilet - Ribonucleases, 2011 - Springer
     
    7. Nucleases of metallo-_-lactamase and protein phosphatase families in DNA repair; DNA Repair-On the Pathways to Fixing DNA Damage and Errors
    FJ Fernandez, M Lopez-Estepa, MC Vega - 2011 - digital.csic.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch