.
The Open Protein Structure Annotation Network
PDB Keyword
.

2azp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PA1268 Solved by Sulfur SAD. To be Published
    Site MCSG
    PDB Id 2azp Target Id APC5861
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4880,NP_249959.1, 208964 Molecular Weight 33525.91 Da.
    Residues 314 Isoelectric Point 5.45
    Sequence mqririidshtggeptrlviggfpdlgqgdmaerrrllgerhdawraacileprgsdvlvgallcapvd peacagviffnnsgylgmcghgtiglvaslahlgrigpgvhrietpvgeveatlhedgsvsvrnvpayr yrrqvsvevpgigrvsgdiawggnwfflvaghgqrlagdnldaltaytvavqqalddqdirgedggaid hielfaddphadsrnfvlcpgkaydrspcgtgtsaklaclaadgkllpgqpwrqasvigsqfegryewl dgqpggpivptirgrahvsaeatllladddpfawgirr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.13 Rfree 0.209
    Matthews' coefficent 2.60 Rfactor 0.175
    Waters 262 Solvent Content 52.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2azp
    1. Prediction of functional sites based on the fuzzy oil drop model
    M Bryli_ski, K Prymula, W Jurkowski - PLoS computational , 2007 - dx.plos.org
     
    2. Molecular and structural discrimination of proline racemase and hydroxyproline-2-epimerase from nosocomial and bacterial pathogens
    M Goytia, N Chamond, A Cosson, N Coatnoan - PloS one, 2007 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch