.
The Open Protein Structure Annotation Network
PDB Keyword
.

2azw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.9A crystal structure of the MutT/nudix family protein from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2azw Target Id APC28983
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5429,AAO80941, 226185 Molecular Weight 17024.25 Da.
    Residues 148 Isoelectric Point 5.42
    Sequence mktptfgkreetltyqtryaayiivskpenntmvlvqapngayflpggeiegtetkeeaihrevleelg isveigcylgeadeyfysnhrqtayynpgyfyvantwrqlseplertntlhwvapeeavrllkrgshrw avekwlaaas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.22969
    Matthews' coefficent 3.19 Rfactor 0.19303
    Waters 160 Solvent Content 61.00

    Ligand Information
    Ligands 1PE (PENTAETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2azw
    1. The AnnoLite and AnnoLyze programs for comparative annotation of protein structures
    MA Marti-Renom, A Rossi, F Al-Shahrour - BMC , 2007 - biomedcentral.com
     
    2. Structure based prediction of functional sites with potential inhibitors to Nudix enzymes from disease causing microbes
    A Sharma, AV Tendulkar, PP Wangikar - Bioinformation, 2011 - ncbi.nlm.nih.gov
     
    3. Structural and ligand-binding properties of a dual substrate specific enzyme from Schizosaccharomyces pombe
    JA Garza - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch