.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b06

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.4 A crystal structure of the MutT/nudix family protein from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2b06 Target Id APC80455
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5604,AAK75341, 170187 Molecular Weight 17996.37 Da.
    Residues 155 Isoelectric Point 4.47
    Sequence msrsqltiltnicliedletqrvvmqyrapennrwsgyafpgghvendeafaesvireiyeetgltiqn pqlvgiknwpldtggryivicykatefsgtlqsseegevswvqkdqipnlnlaydmlplmemmeapdks effyprrteddwekkif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.21923
    Matthews' coefficent 1.94 Rfactor 0.1889
    Waters 227 Solvent Content 36.00

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2b06
    1. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     
    2. Structure based prediction of functional sites with potential inhibitors to Nudix enzymes from disease causing microbes
    A Sharma, AV Tendulkar, PP Wangikar - Bioinformation, 2011 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch