.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b20

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase. To be Published
    Site MCSG
    PDB Id 2b20 Target Id APC27316
    Related PDB Ids 3c87 3c8d 3c8h 
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5384,AAP16019, 198215 Molecular Weight 45605.54 Da.
    Residues 400 Isoelectric Point 5.76
    Sequence mtalkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqpqsmq riagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiadplnpqswkgglg havsalempqaplqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaq smpvwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdradrtv vagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsaeglrivleagire pmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlwqplfhdrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.95 Rfree 0.27738
    Matthews' coefficent 3.10 Rfactor 0.22178
    Waters 50 Solvent Content 60.80

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2b20
    1. Siderophore-based iron acquisition and pathogen control
    M Miethke, MA Marahiel - Microbiology and Molecular Biology , 2007 - Am Soc Microbiol
     
    2. Structural characterization of enterobactin hydrolase IroE
    NA Larsen, H Lin, R Wei, MA Fischbach, CT Walsh - Biochemistry, 2006 - ACS Publications
     
    3. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    4. Cloning, purification, crystallization and preliminary X-ray analysis of ESX-1-secreted protein regulator (EspR) from Mycobacterium tuberculosis
    SP Gangwar, SR Meena, AK Saxena - Crystallographica Section F: , 2010 - scripts.iucr.org
     
    5. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch