.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b6c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Xray structure of predicted DNA alkylation repair enzyme from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2b6c Target Id APC29610
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5466,AAO82750, 226185 Molecular Weight 25600.22 Da.
    Residues 217 Isoelectric Point 8.76
    Sequence mdtlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyqktereyq yvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltelptifalfygaenfwnr rvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrqysktnpqwveelmkelvlsplaqre gskylakase
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.20164
    Matthews' coefficent 3.10 Rfactor 0.15833
    Waters 305 Solvent Content 60.40

    Ligand Information
    Ligands SO4 (SULFATE) x 5;BME (BETA-MERCAPTOETHANOL) x 2;GOL (GLYCEROL) x 4
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2b6c
    1. Protein structure homology modeling using SWISS-MODEL workspace
    L Bordoli, F Kiefer, K Arnold, P Benkert, J Battey - Nature protocols, 2008 - nature.com
     
    2. Identification of DNA-binding proteins using structural, electrostatic and evolutionary features
    G Nimrod, A Szilgyi, C Leslie, N Ben-Tal - Journal of molecular biology, 2009 - Elsevier
     
    3. Structural insight into repair of alkylated DNA by a new superfamily of DNA glycosylases comprising HEAT-like repeats
    B Dalhus, IH Helle, PH Backe, I Alseth - Nucleic acids , 2007 - Oxford Univ Press
     
    4. A new protein architecture for processing alkylation damaged DNA: the crystal structure of DNA glycosylase AlkD
    EH Rubinson, AH Metz, J O'Quin - Journal of molecular , 2008 - Elsevier
     
    5. Definitive benchmark study of ring current effects on amide proton chemical shifts
    AS Christensen, SPA Sauer - Journal of Chemical , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch