.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b81

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Luciferase-like Monooxygenase from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 2b81 Target Id APC24947
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5316,AAP10314, 226900 Molecular Weight 36654.01 Da.
    Residues 320 Isoelectric Point 5.72
    Sequence mkhmekfanhfgynrmfakdqltlgvhipienyqfhaptmekqvelvqkaeqygftgvwlrdvllqdpd fgdpatgqiydmmiyltylasktekiafgtsatvlslrhplrvakeiatldqlfperimlgvssgdrra dfkalgvshetrgekfreafayleeilyknfpsiqstlgevhganlvpkpskrvptfitgfsqqnmewf aehgdgwmyyprspvhqagaigqwrelvedyhpdvfkpfiqpmhldlsedpnerptpirlgyrtgrkal ielldiyksigvnhlflalfdgqrpadevldelgeevlphfpal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.21833
    Matthews' coefficent 6.80 Rfactor 0.18261
    Waters 1044 Solvent Content 82.00

    Ligand Information
    Ligands SO4 (SULFATE) x 39;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 5;GOL (GLYCEROL) x 5
    Metals

    Jmol

     
    Google Scholar output for 2b81
    1. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    2. In silico approach to discover multi-target-directed ligands for the treatment of Alzheimer's disease
    A Tyagi, S Gupta, CG Mohan - Proceedings of the International , 2010 - dl.acm.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch