.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bbe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein SO0527 from Shewanella oneidensis. To be Published
    Site MCSG
    PDB Id 2bbe Target Id APC83652
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5708,NP_716163, 211586 Molecular Weight 12316.34 Da.
    Residues 108 Isoelectric Point 5.45
    Sequence mstsadykinqqqivcvasflskegktealiaalaslipdtrreagciryelnvsrdeprrvtfvekfv diaafdehcakdaiqhyfhqvmpelvesfhvetyhqvia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.97 Rfree 0.19536
    Matthews' coefficent 4.37 Rfactor 0.17237
    Waters 158 Solvent Content 71.83

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2bbe
    1. Structural insight of the role of the Hahella chejuensis HapK protein in prodigiosin biosynthesis
    HJ Cho, KJ Kim, MH Kim - : Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch