.
The Open Protein Structure Annotation Network
PDB Keyword
.

2be3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a GTP Pyrophosphokinase Family Protein from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2be3 Target Id APC80416
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5600,AAK75209, 170187 Molecular Weight 26181.45 Da.
    Residues 223 Isoelectric Point 5.71
    Sequence mtleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmarrgityatlehd lqdiaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhvvveytvdtingaktila eiqirtlamnfwatiehslnykyqgdfpdeikkrleitariahqldeemgeirddiqeaqalfdplsrk lndgvgnsddtdeeyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.23423
    Matthews' coefficent 2.55 Rfactor 0.18219
    Waters 251 Solvent Content 51.80

    Ligand Information
    Ligands PG4 (TETRAETHYLENE) x 1;GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2be3
    1. Bacteria possessing two RelA/SpoT-like proteins have evolved a specific stringent response involving the acyl carrier protein-SpoT interaction
    A Battesti, E Bouveret - Journal of bacteriology, 2009 - Am Soc Microbiol
     
    2. Dynamic features of homo_dimer interfaces calculated by normal mode analysis
    Y Tsuchiya, K Kinoshita, S Endo, H Wako - Protein Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch