.
The Open Protein Structure Annotation Network
PDB Keyword
.

2csg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Oxidoreductase from Salmonella typhimurium LT2. To be Published
    Site MCSG
    PDB Id 2csg Target Id APC23035
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5249,NP_459818, 99287 Molecular Weight 47233.10 Da.
    Residues 421 Isoelectric Point 5.43
    Sequence mttpfthetlpadpkaairqmkqalraqigdvqavfdrlsatiaarvaeindlkaqgqpvwpiipfsel amgnisdatraevkrrgcavikghfpreqalawdqsmldyldknhfdevykgpgdnffgtlsasrpeiy pvywsqaqmqarqseemalaqsflnrlwqvehdgkrwfnpdisiiypdrirrrppgttskglgahtdsg alerwllpayqqvfasvfngnveqydpwnaahrtdveeytvdnttkcsvfrtfqgwtalsdmlpgqgll hvvpipeamayillrpllddvpedelcgvapgrvlpiseqwhpllmaaltsippleagdsvwwhcdvih svapvenqqgwgnvmyipaapmceknlayarkvkaaletgaspgdfpredyettwegrftlrdlnihgk ralgidv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.23749
    Matthews' coefficent 4.00 Rfactor 0.18759
    Waters 64 Solvent Content 69.50

    Ligand Information
    Ligands ICT (ISOCITRIC) x 1;SIN (SUCCINIC) x 1;CIT (CITRIC) x 1
    Metals FE (FE) x 1

    Jmol

     
    Google Scholar output for 2csg
    1. Ab Initio Structural Modeling of and Experimental Validation for Chlamydia trachomatis Protein CT296 Reveal Structural Similarity to Fe (II) 2-Oxoglutarate-Dependent
    KE Kemege, JM Hickey, S Lovell, KP Battaile - Journal of , 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch