.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d7v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961. TO BE PUBLISHED
    Site MCSG
    PDB Id 2d7v Target Id APC26922
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5372,AAF96238, 243277 Molecular Weight 16998.41 Da.
    Residues 155 Isoelectric Point 6.14
    Sequence smsehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsveanvdpeeafvaalss chmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrpqvvfsgtskptlqqlekmhhlahe ncfiansvetevvteii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.97 Rfree 0.25846
    Matthews' coefficent 2.21 Rfactor 0.19925
    Waters 88 Solvent Content 44.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch