.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d9r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein PG0164 frpm Porphyromonas gingivalis [W83]. To be published
    Site MCSG
    PDB Id 2d9r Target Id APC80749
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5620,AAQ65404.1, 242619 Molecular Weight 11456.64 Da.
    Residues 104 Isoelectric Point 8.76
    Sequence mkktlpkteapssvgngsdspiefdaiirqvpdmdaayveipfdvktvygkgrvrvnatfdgypytgyi vrmglpchilglrqdirraigkqpgdsvyvtllpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.22715
    Matthews' coefficent 2.19 Rfactor 0.17829
    Waters 79 Solvent Content 43.73

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 1
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2d9r
    1. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch