.
The Open Protein Structure Annotation Network
PDB Keyword
.

2esn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of putative transcriptional regulator Pa0477 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2esn Target Id APC5828
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4863,AAG03866, 208964 Molecular Weight 34052.04 Da.
    Residues 308 Isoelectric Point 8.17
    Sequence mhpllrrldlnlllvfdalyrhrnvgtaaselaisasafshalgrlrqglddelflrqgnrmqptqrae hlaaavaaalralgegleewrpfvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerk lsvealasgridfalgydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpw nedsgvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapfdippy vlrlyshvqhvgrdahawmigqlkgldisrtg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.25117
    Matthews' coefficent 2.62 Rfactor 0.19371
    Waters 770 Solvent Content 53.04

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2esn
    1. Full-length structures of BenM and two variants reveal different oligomerization schemes for LysR-type transcriptional regulators
    A Ruangprasert, SH Craven, EL Neidle - Journal of molecular , 2010 - Elsevier
     
    2. Crystal structures of DntR inducer binding domains in complex with salicylate offer insights into the activation of LysR_type transcriptional regulators
    L Devesse, I Smirnova, R Lnneborg - Molecular , 2011 - Wiley Online Library
     
    3. The structure of a reduced form of OxyR from Neisseria meningitidis
    S Sainsbury, J Ren, J Nettleship - BMC structural , 2010 - biomedcentral.com
     
    4. Structure of the effector-binding domain of the LysR-type transcription factor RovM from Yersinia pseudotuberculosis
    N Quade, M Dieckmann, M Haffke - Section D: Biological , 2011 - scripts.iucr.org
     
    5. Structural characterization and biophysical studies of BenM, a LysR-type transcriptional regulator in Acinetobacter baylyi ADP1
    A Ruangprasert - 2010 - ugakr-maint.libs.uga.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch