.
The Open Protein Structure Annotation Network
PDB Keyword
.

2evv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein HP0218 from Helicobacter pylori. To be Published
    Site MCSG
    PDB Id 2evv Target Id APC5807
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS4845,NP_207016.1, 85962 Molecular Weight 20688.82 Da.
    Residues 183 Isoelectric Point 9.10
    Sequence mktfevmiqtdskgyldakfggnapkaflnsnglptyspkiswqkvegaqsyalelidhdaqkvcgmpf vhwvvgniahnvleenasmmdkrivqgvnsltqgfirsplnesekqrsnlnnsvyigpmppngdhhyli qvyaldipklalkapfflgdlhdkmrnhiiaigrkeflykqfvrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.59 Rfree 0.26248
    Matthews' coefficent 3.93 Rfactor 0.2191
    Waters 267 Solvent Content 68.68

    Ligand Information
    Ligands GOL (GLYCEROL) x 4;SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2evv
    1. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch