.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ewc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of hypothetical protein from Streptococcus pyogenes M1 GAS, member of highly conserved yjgF family of proteins. To be Published
    Site MCSG
    PDB Id 2ewc Target Id APC80136
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5580,AAK34723, 160490 Molecular Weight 14404.71 Da.
    Residues 126 Isoelectric Point 5.76
    Sequence mktirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltldavvqmdcl frdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskhismt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.15 Rfree 0.20439
    Matthews' coefficent 2.67 Rfactor 0.16217
    Waters 1058 Solvent Content 53.86

    Ligand Information
    Ligands GOL (GLYCEROL) x 5
    Metals

    Jmol

     
    Google Scholar output for 2ewc
    1. Structure of a nickel chaperone, HypA, from Helicobacter pylori reveals two distinct metal binding sites
    W Xia, H Li, KH Sze, H Sun - Journal of the American Chemical , 2009 - ACS Publications
     
    2. Crystal structure of HypA, a nickel-binding metallochaperone for [NiFe] hydrogenase maturation
    S Watanabe, T Arai, R Matsumi, H Atomi - Journal of molecular , 2009 - Elsevier
     
    3. Structural Studies of Thiamin Monophosphate Kinase in Complex with Substrates and Products,
    KM McCulloch, C Kinsland, TP Begley, SE Ealick - Biochemistry, 2008 - ACS Publications
     
    4. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch