.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f06

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein BT0572 from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 2f06 Target Id APC81344
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5653,AAO75679.1, 226186 Molecular Weight 15349.98 Da.
    Residues 141 Isoelectric Point 5.41
    Sequence mvakqlsiflenksgrltevtevlakeninlsalciaenadfgilrgivsdpdkaykalkdnhfavnit dvvgiscpnvpgalakvlgflsaegvfieymysfannnvanvvirpsnmdkcievlkekkvdllaasdl ykl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.24941
    Matthews' coefficent 2.34 Rfactor 0.20252
    Waters 85 Solvent Content 47.40

    Ligand Information
    Ligands HIS x 2
    Metals

    Jmol

     
    Google Scholar output for 2f06
    1. Critical role of the FERM domain in Pyk2 stimulated glioma cell migration
    CA Lipinski, NL Tran, A Dooley, YP Pang - Biochemical and , 2006 - Elsevier
     
    2. The Thermus thermophilus DEAD box helicase Hera contains a modified RNA recognition motif domain loosely connected to the helicase core
    MG Rudolph, D Klostermeier - RNA, 2009 - rnajournal.cshlp.org
     
    3. Solution structure of the GUCT domain from human RNA helicase II/Gu_ reveals the RRM fold, but implausible RNA interactions
    S Ohnishi, K Pkknen, S Koshiba - Proteins: Structure, , 2009 - Wiley Online Library
     
    4. Solution structure of HI1506, a novel two_domain protein from Haemophilus influenzae
    N Sari, Y He, V Doseeva, K Surabian - Protein , 2007 - Wiley Online Library
     

    Protein Summary

    Structure of the protein BT0572 from Bacteroides thetaiotaomicron  contains two repeats of the flavodoxin-like ACT domain.  Proteins containing such pairs of ACT domains usually bind specifically to a particular amino acid leading to regulation of the linked enzyme that is typically regulated by this amino acid concentration.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch