.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f2e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The X-ray crystal structure of PA1607 from Pseudomonas aureginosa at 1.9 A resolution--a putative transcription factor. Protein Sci. 16 543-549 2007
    Site MCSG
    PDB Id 2f2e Target Id APC5613
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4723,AAG04996.1, 208964 Molecular Weight 16207.61 Da.
    Residues 146 Isoelectric Point 7.95
    Sequence mvkrtshkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlvehgvmva vpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvprlqvragdgsplaa edtrvsrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.25099
    Matthews' coefficent 2.23 Rfactor 0.17697
    Waters 329 Solvent Content 44.75

    Ligand Information
    Ligands SO4 (SULFATE) x 4;GLC (ALPHA-D-GLUCOSE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2f2e
    1. Prediction of protein_glucose binding sites using support vector machines
    H Nassif, H Al_Ali, S Khuri - : Structure, Function, and , 2009 - Wiley Online Library
     
    2. The X_ray crystal structure of PA1607 from Pseudomonas aureginosa at 1.9 resolutiona putative transcription factor
    EAL Sieminska, X Xu, A Savchenko - Protein , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch