.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f96

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of RNase T, an Exoribonuclease Involved in tRNA Maturation and End Turnover. Structure 15 417-428 2007
    Site MCSG
    PDB Id 2f96 Target Id APC5754
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4804,AAG06916.1, 208964 Molecular Weight 24721.46 Da.
    Residues 224 Isoelectric Point 5.02
    Sequence msednfddefdgslpsgprhpmarrfrgylpvvvdvetggfnsatdalleiaattvgmdekgflfpeht yffriepfeganiepaaleftgikldhplrmavqeeaalteifrgirkalkangckrailvghnssfdl gflnaavartgikrnpfhpfssfdtatlaglaygqtvlakacqaagmefdnreahsarydtektaelfc givnrwkemggwmdddd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.20448
    Matthews' coefficent 2.38 Rfactor 0.15775
    Waters 230 Solvent Content 48.32

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2f96
    1. Nucleases: diversityofstructure, function and mechanism
    W Yang - 2011 - Cambridge Univ Press
     
    2. Structure of the dimeric exonuclease TREX1 in complex with DNA displays a proline-rich binding site for WW domains
    M Brucet, J Querol-Aud, M Serra - Journal of Biological , 2007 - ASBMB
     
    3. Crystal structure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover
    Y Zuo, H Zheng, Y Wang, M Chruszcz, M Cymborowski - Structure, 2007 - Elsevier
     
    4. Duality of polynucleotide substrates for Phi29 DNA polymerase: 3__ 5_ RNase activity of the enzyme
    A Lagunavicius, Z Kiveryte, V Zimbaite-Ruskuliene - RNA, 2008 - rnajournal.cshlp.org
     
    5. Structural basis for RNA trimming by RNase T in stable RNA 3 [prime]-end maturation
    YY Hsiao, CC Yang, CL Lin, JLJ Lin, Y Duh - Nature Chemical , 2011 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch