.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fb1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein BT0354 from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 2fb1 Target Id APC81302
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5650,AAO75461.1, 226186 Molecular Weight 25893.47 Da.
    Residues 225 Isoelectric Point 5.86
    Sequence mknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaakrvlaeltg lenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvninelpalifdhpemvdka remmkqkasvepigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrga alykfngkayrkdpkfkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.25062
    Matthews' coefficent 3.36 Rfactor 0.19789
    Waters 270 Solvent Content 63.41

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2fb1
    1. Transcriptional regulation of NAD metabolism in bacteria: NrtR family of Nudix-related regulators
    DA Rodionov, J De Ingeniis, C Mancini - Nucleic acids , 2008 - Oxford Univ Press
     
    2. Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
    N Huang, J De Ingeniis, L Galeazzi, C Mancini - Structure, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch