.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fb5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the hypothetical membrane spanning protein from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 2fb5 Target Id APC25179
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5326,AAP11793, 226900 Molecular Weight 22206.20 Da.
    Residues 201 Isoelectric Point 5.31
    Sequence mhewglseelkiqtkqmieiaekelsimrnaidkedecilckmedihhmlanvqtlaatyyiqaylspy tesssfittaiqhlsarkhgalivvernetlealiqtgttlnahltapllesifypgnplhdgavlvkn nhivsaanilpltkstevdpelgtrhraaiglseksdalilvvseetgrtsfalngilytisl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.99 Rfree 0.2153
    Matthews' coefficent 3.44 Rfactor 0.18151
    Waters 846 Solvent Content 64.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fb5
    1. Structural biochemistry of a bacterial checkpoint protein reveals diadenylate cyclase activity regulated by DNA recombination intermediates
    G Witte, S Hartung, K Bttner, KP Hopfner - Molecular cell, 2008 - Elsevier
     
    2. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch