.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fbh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of transcriptional regulator PA3341. To be Published
    Site MCSG
    PDB Id 2fbh Target Id APC5857
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4876,NP_252031.1, 208964 Molecular Weight 16070.52 Da.
    Residues 144 Isoelectric Point 8.02
    Sequence maqtdkhyfgtllaqtsrawraeldrrlshlglsqarwlvllhlarhrdsptqrelaqsvgvegptlar lldglesqglvrrlavaedrrakhivltpkadvliadieaiaasvrndvltgideseqalcqqvllril anlenr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.23284
    Matthews' coefficent 2.02 Rfactor 0.19493
    Waters 129 Solvent Content 39.18

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals HG (MERCURY) x 1;ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2fbh
    1. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     
    2. Solution Structure of Escherichia coli PapI, a Key Regulator of the Pap Pili Phase Variation
    T Kawamura, LUK Le, H Zhou, FW Dahlquist - Journal of molecular biology, 2007 - Elsevier
     
    3. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    4. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch