.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fcj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of small TOPRIM domain from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 2fcj Target Id APC35832
    Related PDB Ids 2i5r 
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5513,RBSTP2199, 1422 Molecular Weight 13696.98 Da.
    Residues 119 Isoelectric Point 5.51
    Sequence mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladadeageklrrq frrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.30 Rfree 0.21399
    Matthews' coefficent 1.88 Rfactor 0.1919
    Waters 393 Solvent Content 34.60

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;SO4 (SULFATE) x 2;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fcj
    1. Crystal structure and putative function of small Toprim domain_containing protein from Bacillus stearothermophilus
    P _ez_ov, D Borek, SF Moy - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch