.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fe7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a N-acetyltransferase from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2fe7 Target Id APC5777
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4822,AAG03867.1, 208964 Molecular Weight 18108.54 Da.
    Residues 158 Isoelectric Point 4.97
    Sequence mtleirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptralmclsegrpigyavyf ysystwlgrngiyledlyvtpeyrgvgagrrllrelareavandcgrlewsvldwnqpaidfyrsigal pqdewvryrldgealrkmae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.22124
    Matthews' coefficent 2.83 Rfactor 0.18753
    Waters 301 Solvent Content 56.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fe7
    1. A Chemoinformatics Approach to Identify Bioisosteric Scaffold Replacements in Compounds of PubChem Bioassays
    K Hhfeld - 2009 - deposit.ddb.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch