.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fg1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a hypothetical protein from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 2fg1 Target Id APC81494
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5655,AAO76364.1, 226186 Molecular Weight 17385.50 Da.
    Residues 155 Isoelectric Point 8.36
    Sequence meilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeftlgavqfvn venklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmprigcglaggkwelmeqi ikeelitkeiavtvydl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.25 Rfree 0.18127
    Matthews' coefficent 1.97 Rfactor 0.16804
    Waters 272 Solvent Content 37.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fg1
    1. Orphan Macrodomain Protein (Human C6orf130) Is an O-Acyl-ADP-ribose Deacylase
    FC Peterson, D Chen, BL Lytle, MN Rossi, I Ahel - Journal of Biological , 2011 - ASBMB
     
    2. Statistical measures on residue-level protein structural properties
    Y Huang, S Bonett, A Kloczkowski, R Jernigan - Journal of structural and , 2011 - Springer
     

    Protein Summary

    This Bacteroides thetaiotaomicron protein contains a single domain of a ADP-ribose binding module. This module is found in a number of otherwise unrelated proteins from bacteria, archea, viruses and eukaryotes.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch