.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fhp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Methylase from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2fhp Target Id APC29422
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5452,AAO82170, 226185 Molecular Weight 20760.87 Da.
    Residues 184 Isoelectric Point 5.47
    Sequence mrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglaieavsrgmdksic ieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlldppyakqeivsqlekmler qlltneavivcetdktvklpetigtlkktretvygitqvtiyrqea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.21499
    Matthews' coefficent 2.15 Rfactor 0.17899
    Waters 461 Solvent Content 42.85

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fhp
    1. Structural and Functional Characterization of Rv2966c Protein Reveals an RsmD-like Methyltransferase from Mycobacterium tuberculosis and the Role of Its N-
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     
    2. Structural and functional characterization of Rv2966c reveals an RsmD-like methyltransferase from M. tuberculosis and the role of its N-terminal domain in target
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch