.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fhq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron. To be Published 2006
    Site MCSG
    PDB Id 2fhq Target Id APC81532
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5665,AAO76536.1, 226186 Molecular Weight 15408.99 Da.
    Residues 138 Isoelectric Point 5.40
    Sequence mstktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidflsnpkagl cfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftanhatywiegtfihkkld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.87 Rfree 0.25347
    Matthews' coefficent 2.12 Rfactor 0.19284
    Waters 225 Solvent Content 41.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fhq
    1. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     

    Protein Summary

    This Bacteroides thetaiotaomicron protein has a FMN-binding split barrel fold and belongs to the Pyridoxamine 5'-phosphate oxidase family (PFAM01243).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch