.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fi0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the conserved domain protein from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 2fi0 Target Id APC80285
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5593,AAK74717, 170187 Molecular Weight 8854.97 Da.
    Residues 81 Isoelectric Point 5.05
    Sequence mevvmdniidvsipvaevvdkhpevleilvelgfkplanplmrntvgrkvslkqgsklagtpmdkivrt leangyevigld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.23627
    Matthews' coefficent 3.83 Rfactor 0.20281
    Waters 57 Solvent Content 67.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fi0
    1. COMPASS server for homology detection: improved statistical accuracy, speed and functionality
    RI Sadreyev, M Tang, BH Kim - Nucleic acids research, 2009 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch