.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fi9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.8A crystal structure of an outer membrane protein from the Bartonella henselae. To be Published
    Site MCSG
    PDB Id 2fi9 Target Id APC84470
    Molecular Characteristics
    Source Bartonella henselae str. houston-1
    Alias Ids TPS5738,CAF27373.1, 283166 Molecular Weight 14008.26 Da.
    Residues 128 Isoelectric Point 4.89
    Sequence mshaiqireahfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedisrvleesdqi evlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedravaallfave
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2342
    Matthews' coefficent 1.99 Rfactor 0.19927
    Waters 53 Solvent Content 38.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fi9
    1. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch