.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fia

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the acetyltransferase from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2fia Target Id APC29228
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5436,AAO81671, 226185 Molecular Weight 19410.53 Da.
    Residues 162 Isoelectric Point 6.97
    Sequence mkirvadekelpmilqfltevkaymdvvgitqwtkdypsqgdiqeditkkrlyllvheemifsmatfcm eqeqdfvwlkrfatspnyiakgygsllfhelekravwegrrkmyaqtnhtnhrmirffeskgftkihes lqmnrldfgsfylyvkelenqsiv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.25885
    Matthews' coefficent 4.00 Rfactor 0.20971
    Waters 160 Solvent Content 69.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fia
    1. Three_dimensional domain swapping in the protein structure space
    Y Huang, H Cao, Z Liu - Proteins: Structure, Function, and , 2012 - Wiley Online Library
     
    2. Structure and mechanism of peptide-induced membrane pores
    S Qian - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch