.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fl4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2fl4 Target Id APC28969
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5428,AAO80887, 226185 Molecular Weight 17394.74 Da.
    Residues 148 Isoelectric Point 5.07
    Sequence meihfekvtsdnrkavenlqvfaeqqafiesmaenlkesdqfpewesagiydgnqligyamygrwqdgr vwldrflidqrfqgqgygkaacrllmlkliekyqtnklylsvydtnssairlyqqlgfvfngeldtnge rvmewthqnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.24865
    Matthews' coefficent 2.34 Rfactor 0.21159
    Waters 172 Solvent Content 47.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fl4
    1. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch