.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fml

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MutT/nudix family protein from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2fml Target Id APC29501
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5456,AAO82404, 226185 Molecular Weight 31461.97 Da.
    Residues 273 Isoelectric Point 5.53
    Sequence mpqfaskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvlliqrkghpfr nswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgwvvtvsylafigeepli agddakevhwfnlerhgqhitlshedveitldlktaaslgkdtlafdhseiiikafnrvvdkmehepqv lqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgerpvgigrpskiyqlktttgf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.26 Rfree 0.24086
    Matthews' coefficent 2.88 Rfactor 0.19162
    Waters 264 Solvent Content 57.28

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fml
    1. Transcriptional regulation of NAD metabolism in bacteria: NrtR family of Nudix-related regulators
    DA Rodionov, J De Ingeniis, C Mancini - Nucleic acids , 2008 - Oxford Univ Press
     
    2. Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
    N Huang, J De Ingeniis, L Galeazzi, C Mancini - Structure, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch