.
The Open Protein Structure Annotation Network
PDB Keyword
.

2for

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Shigella flexneri Farnesyl Pyrophosphate Synthase Complex with an Isopentenyl Pyrophosphate. To be Published
    Site MCSG
    PDB Id 2for Target Id APC27281
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5382,AAP15892, 198215 Molecular Weight 32140.75 Da.
    Residues 299 Isoelectric Point 5.39
    Sequence mdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgvstntldap aaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtlafsilsdanmpevsdrdr ismiselasasgiagmcggqaldldaegkhvpldalerihrhktgaliraavrlgalsagdkgrralpv ldkyaesiglafqvqddildvvgdtatlgkrqgadqqlgkstypallgleqarkkardliddarqalkq laeqsldtsalealadyiiqrnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2329
    Matthews' coefficent 2.56 Rfactor 0.18115
    Waters 354 Solvent Content 52.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6;IPR (ISOPENTYL) x 1;PO4-IPR (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2for
    1. Improved pruning algorithms and divide-and-conquer strategies for dead-end elimination, with application to protein design
    I Georgiev, RH Lilien, BR Donald - Bioinformatics, 2006 - Oxford Univ Press
     
    2. Naturally occurring and synthetic peptides acting on nicotinic acetylcholine receptors
    IE Kasheverov, YN Utkin - Current pharmaceutical , 2009 - ingentaconnect.com
     
    3. Structure-based drug design targeting biosynthesis of isoprenoids: a crystallographic state of the art of the involved enzymes
    J Ruyck, J Wouters - Current Protein and Peptide Science, 2008 - ingentaconnect.com
     
    4. Structural analysis of farnesyl pyrophosphate synthase from parasitic protozoa, a potential chemotherapeutic target
    A Srivastava, P Mukherjee, PV Desai - Current Drug Targets , 2008 - ingentaconnect.com
     
    5. From small to big: understanding noncovalent interactions in chemical systems from quantum mechanical models
    AL Ringer - 2009 - books.google.com
     
    6. Neoculin as a New Sweet Protein with Taste-Modifying Activity: Purification, Characterization, and X-ray Crystallography
    A Shimizu-Ibuka, Y Morita, K Nakajima - ACS symposium , 2008 - ACS Publications
     
    7. Sensing Single Protein Molecules with Solid-State Nanopores
    B Ledden, D Fologea, DS Talaga - Nanopores: Sensing and , 2011 - books.google.com
     
    8. The functional importance of a pair of conserved glutamic acid residues and of Ca2+ binding in the cbb3type oxygen reductases from Rhodobacter sphaeroides and
    H Ouyang, H Han, JH Roh, J Hemp, JP Hosler - Biochemistry, 2012 - ACS Publications
     
    9. Fundamentals of Enzyme Kinetics: Michaelis-Menten and Deviations
    N Cermak - 2009 - cermak.scripts.mit.edu
     
    10. Topics in Nucleic Acids Structure: Noncanonical Helices and RNA Structure
    T Schlick - Modeling and Simulation: An Interdisciplinary Guide, 2010 - Springer
     
    11. The N-terminus of the human RecQL4 helicase is a homeodomain-like DNA interaction motif
    O Ohlenschlger, A Kuhnert, A Schneider - Nucleic Acids , 2012 - Oxford Univ Press
     
    12. Target bindingto S100B reduces dynamic properties and increases Ca 2+-binding affinity for wild type and EF-hand mutant proteins
    MA Liriano, KM Varney, NT Wright, CL Hoffman - Journal of Molecular , 2012 - Elsevier
     
    13. Interfacial water molecules in SH3 interactions: Getting the full picture on polyproline recognition by protein-protein interaction domains
    A Zafra-Ruano, I Luque - FEBS letters, 2012 - Elsevier
     
    14. The Structure and Dynamics of Gene Regulation Networks
    M Tu_rul - Arxiv preprint arXiv:0802.1989, 2008 - arxiv.org
     
    15. Representing chemical structures using OWL and discriptions graphs
    JK Hastings - 2010 - uir.unisa.ac.za
     
    16. Anti-platelet membrane glycoprotein VI monoclonal antibody
    H Takayama - EP Patent 2,363,416, 2011 - freepatentsonline.com
     
    17. A framework for the management of changing biological experimentation
    B Tagger - 2010 - eprints.ucl.ac.uk
     
    18. Algorithmic Infrastructure for the Prediction of Structure and Motion in Transmembrane Proteins
    A Enosh - 2008 - primage.tau.ac.il
     
    19. ANTI-PLATELET MEMBRANE GLYCOPROTEIN VI MONOCLONAL ANTIBODY
    H Takayama - EP Patent 1,876,240, 2008 - freepatentsonline.com
     
    20. Essays on infrastructure, female labor force participation and economic development
    G Cubas Norando - 2010 - ir.uiowa.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch