.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fpo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure. J.Biol.Chem. 282 5880-5887 2007
    Site MCSG
    PDB Id 2fpo Target Id APC076
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4439,AAC76490, 562 Molecular Weight 21676.42 Da.
    Residues 198 Isoelectric Point 5.96
    Sequence mkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrglleet inlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaqgesdad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.2169
    Matthews' coefficent 2.49 Rfactor 0.1833
    Waters 390 Solvent Content 50.53

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals CL (CHLORIDE) x 6

    Jmol

     
    Google Scholar output for 2fpo
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Methyltransferase that modifies guanine 966 of the 16 S rRNA
    DV Lesnyak, J Osipiuk, T Skarina, PV Sergiev - Journal of Biological , 2007 - ASBMB
     
    3. COMPASS server for remote homology inference
    RI Sadreyev, M Tang, BH Kim - Nucleic acids research, 2007 - Oxford Univ Press
     
    4. Crystal structure of tRNA N2, N2-guanosine dimethyltransferase Trm1 from Pyrococcus horikoshii
    M Nishimoto, K Higashijima, M Shirouzu - Journal of molecular , 2008 - Elsevier
     
    5. Structural and Functional Characterization of Rv2966c Protein Reveals an RsmD-like Methyltransferase from Mycobacterium tuberculosis and the Role of Its N-
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     
    6. Structural and functional characterization of Rv2966c reveals an RsmD-like methyltransferase from M. tuberculosis and the role of its N-terminal domain in target
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch