.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fu2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of pyogenecin immunity protein, a novel bacteriocin-like immunity protein from Streptococcus pyogenes. Bmc Struct.Biol. 9 75-75 2009
    Site MCSG
    PDB Id 2fu2 Target Id APC80158
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5582,AAK34789, 160490 Molecular Weight 11314.37 Da.
    Residues 102 Isoelectric Point 6.06
    Sequence mpsekeildalskvyseqviqaddyfrqaifelasqlekegmssllatkidslinqyilthqfdapksi fdlsrlvktkashykgtaisaimlgsflsggpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.25389
    Matthews' coefficent 1.65 Rfactor 0.15732
    Waters 67 Solvent Content 25.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fu2
    1. The structure of pyogenecin immunity protein, a novel bacteriocin-like immunity protein from Streptococcus pyogenes
    C Chang, P Coggill, A Bateman, RD Finn - BMC structural , 2009 - biomedcentral.com
     
    2. The Nudix hydrolase CDP-Chase, a CDP-choline pyrophosphatase, is an asymmetric dimer with two distinct enzymatic activities
    KC Duong-Ly, SB Gabelli, WL Xu, CA Dunn - Journal of , 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch