.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fuv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of phosphoglucomutase from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 2fuv Target Id APC24352
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5293,NP_459683, 99287 Molecular Weight 58086.55 Da.
    Residues 546 Isoelectric Point 5.61
    Sequence maihnragqpaqqsdlinvaqltaqyyvlkpeagnaehavkfgtsghrgsagrhsfnephilaiaqaia eerakngitgpcyvgkdthalsepafisvlevlaangvdvivqenngftptpavsnailvhnkkggpla dgivitpshnppedggikynppnggpadtnvtkvvedranallagglqgvkrisldaamasghvkavdl vqpfvegladivdmaaiqkagltlgvdplggsgieywkriaehyklnltlvndqvdqtfrfmhldkdga irmdcssecamagllalrdkfdlafandpdydrhgivtpaglmnpnhylavainylfqhrplwgkdvav gktlvssamidrvvndlgrklvevpvgfkwfvdglfdgsfgfggeesagasflrfdgtpwstdkdgiim cllaaeitavtgknpqehynelaarfgapsynrlqasatsaqkaalsklspemvsastlagdpitarlt aapgngasigglkvmtdngwfaarpsgtedaykiycesflgeehrkqiekeaveivsevlkna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2001
    Matthews' coefficent 2.34 Rfactor 0.149
    Waters 879 Solvent Content 47.49

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2fuv
    1. New measures for estimating surface complementarity and packing at protein-protein interfaces
    P Mitra, D Pal - FEBS letters, 2010 - Elsevier
     
    2. Crystal structure of a bacterial phosphoglucomutase, an enzyme involved in the virulence of multiple human pathogens
    R Mehra_Chaudhary, J Mick, JJ Tanner - Proteins: Structure, , 2011 - Wiley Online Library
     
    3. Conservation of functionally important global motions in an enzyme superfamily across varying quaternary structures
    EK Luebbering, J Mick, RK Singh, JJ Tanner - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch