.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fyw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 2fyw Target Id APC80559
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5611,AAK75693, 170187 Molecular Weight 29821.37 Da.
    Residues 265 Isoelectric Point 4.70
    Sequence mlaseviqayeafcpqefsmegdsrglqigtldkgiqrvmvaldireetvaeaiekgvdliivkhapif rpikdllasrpqnqiyidlikhdiavyvshtnidivenglndwfcqmlgieettylqetgpergigrig niqpqtfwelaqqvkqvfdldslrmvhyqeddlqkpisrvaicggsgqsfykdalakgadvyitgdiyy htaqdmlsdgllaldpghyievifvekiaallsqwkedkgwsidilpsqastnpfhhi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.40 Rfree 0.25901
    Matthews' coefficent 2.70 Rfactor 0.19988
    Waters 197 Solvent Content 54.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fyw
    1. The 2.2 resolution crystal structure of Bacillus cereus Nif3_family protein YqfO reveals a conserved dimetal_binding motif and a regulatory domain
    MH Godsey, G Minasov, L Shuvalova - Protein , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch