.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fzv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH-dependent FMN reductase activity. Protein Sci. 16 2483-2490 2007
    Site MCSG
    PDB Id 2fzv Target Id APC27867
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5393,AAP17869, 198215 Molecular Weight 28398.75 Da.
    Residues 255 Isoelectric Point 5.90
    Sequence mrlrhlsdpdslpaldksfaierpalglapdappvrilllygslrarsfsrlaveeaarllqffgaetr ifdpsdlplpdqvqsddhpavkelralsewsegqvwcsperhgqitsvmkaqidhlplemagirptqgr tlavmqvsggsqsfnavntlrllgrwmrmftipnqssiakafqefdaagrmkpspyydriadvmeelvr ftalvrphrealtdryserkaaghvideatdlssiaiapqplpesets
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.24579
    Matthews' coefficent 2.14 Rfactor 0.1988
    Waters 1129 Solvent Content 42.59

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2;CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 2fzv
    1. A common structural blueprint for plant UDP-sugar-producing pyrophosphorylases
    AK Leszek, G Matt, F Elisabeth, W Malgorzata - Biochemical Journal, 2011 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch