.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g17

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of N-acetyl-gamma-glutamyl-phosphate reductase from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 2g17 Target Id APC24139
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5287,NP_463001, 99287 Molecular Weight 35947.20 Da.
    Residues 334 Isoelectric Point 5.69
    Sequence mlntlivgasgyagaelvsyvnrhphmtitaltvsaqsndagklisdlhpqlkgivdlplqpmsdvrdf sadvdvvflatahevshdlapqflqagcvvfdlsgafrvndrafyekyygfthqypelleqavyglaew nvdklntanliavpgcyptaaqlslkplidgglldltqwpvinatsgvsgagrkaaisnsfcevslqpy gvfthrhqpeiavhlgaeviftphlgnfprgiletitcrlkagvthaqvadvlqkaygdkplvrlydkg vpalknvvglpfcdigfavqgehlivvatednllkgaaaqavqcanirfgfaetqsli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.19344
    Matthews' coefficent 5.71 Rfactor 0.16962
    Waters 329 Solvent Content 78.45

    Ligand Information
    Ligands SO4 (SULFATE) x 10
    Metals

    Jmol

     
    Google Scholar output for 2g17
    1. Crystal Structure of N-acetyl-_-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP+
    LT Cherney, MM Cherney, CR Garen, C Niu - Journal of molecular , 2007 - Elsevier
     
    2. Novel antagonist antibodies and their Fab fragments against GPVI and uses thereof
    EP Patent 2,397,495, 2011 - freepatentsonline.com
     
    3. Novel antagonist antibodies and their Fab fragments against GPVI and uses thereof
    EP Patent 2,402,371, 2012 - freepatentsonline.com
     
    4. Novel antagonist antibodies and their Fab fragments against GPVI and uses thereof
    EP Patent 2,336,188, 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch