The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2g3a Target Id APC5884
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4899,NP_532931.1, 176299 Molecular Weight 15201.49 Da.
    Residues 137 Isoelectric Point 5.85
    Sequence mnfvlsdvadaeaekairdplvaynlarfgesdkrdlnitirnddnsvtgglvghtargwlyvqllfvp eamrgqgiapkllamaeeearkrgcmgayidtmnpdalrtyerygftkigslgplssgqsitwlekrf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.227
    Matthews' coefficent 2.39 Rfactor 0.186
    Waters 122 Solvent Content 48.49

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch