.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g7l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative transcription regulator SCO7704 from Streptomyces coelicor. To be Published
    Site MCSG
    PDB Id 2g7l Target Id APC6062
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS4995,NP_631742.1, 100226 Molecular Weight 25339.26 Da.
    Residues 235 Isoelectric Point 6.17
    Sequence maarrapisrrdrpakpalsrrwivdtavalmraeglekvtmrrlaqeldtgpaslyvyvantaelhaa vldallgevdltgagaeedwreqlravltsytlvlfahpqlarsalvarpsgenylrlvervlellars gapgaqvawgvdkllqdatataaeqatqehdpashedwsatvralrdadeathpaiashmpllvagsah drlrwsfdvlvngitrtpvpgpargaag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.28587
    Matthews' coefficent 2.67 Rfactor 0.22529
    Waters 59 Solvent Content 53.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g7l
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch