.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g7s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of transcriptional regulator, TetR family, from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2g7s Target Id APC5906
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4917,NP_530985.1, 176299 Molecular Weight 20976.87 Da.
    Residues 192 Isoelectric Point 6.37
    Sequence mknpqskaddilqcartliirggynsfsyadisqvvgirnasihhhfpsksdlvcklvsqyrqeaeagi aeleknisdpleqlrayigywegciadathpfcvcallaseipvlpetvvlevrahfrslsdwltavle rgiaqgrlvltgtaranaeifmatvhgamlsarahgdaatfgaitrpmlerita
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.18605
    Matthews' coefficent 2.27 Rfactor 0.13648
    Waters 321 Solvent Content 45.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g7s
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    3. EM-Fold: De Novo Atomic-Detail Protein Structure Determination from Medium-Resolution Density Maps
    S Lindert, N Alexander, N Wtzel, M Karaka_ - Structure, 2012 - Elsevier
     
    4. CRYO-EM GUIDED DE NOVO PROTEIN FOLDING
    S Lindert - 2011 - etd.library.vanderbilt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch