.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g7u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.3 A structure of putative catechol degradative operon regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2g7u Target Id APC6051
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4992,RHA05304, 101510 Molecular Weight 26999.26 Da.
    Residues 256 Isoelectric Point 5.53
    Sequence mtesdrdyiqsiergfavllafdaqrpnptlaelateaglsrpavrrilltlqklgyvagsggrwsltp rvlsigqhyseshalieaamprllevaektqesaslgvldgadvvyaarvpvrrimsinvsvgtrvpay atsmgrallawapadvvervvaestfqklgpetigtaaelerelakvreqgfaltseelekglislaap vhdaggtvvgvvacstssarntpaqfreqavpcvlaaaaalsadmgfag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.23123
    Matthews' coefficent 2.61 Rfactor 0.18002
    Waters 539 Solvent Content 52.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g7u
    1. HKL-3000: the integration of data reduction and structure solution-from diffraction images to an initial model in minutes
    W Minor, M Cymborowski, Z Otwinowski - Section D: Biological , 2006 - scripts.iucr.org
     
    2. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    3. Different Modes of Binding of Mono-and Biaromatic Effectors to the Transcriptional Regulator TTGV
    ME Guazzaroni, MT Gallegos, JL Ramos - Journal of Biological , 2007 - ASBMB
     
    4. A structural-alphabet-based strategy for finding structural motifs across protein families
    CY Wu, YC Chen, C Lim - Nucleic acids research, 2010 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch