.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g7z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein from Streptococcus pyogenes M1 GAS discloses long-fatty acid (heptadecanoic acid) binding function. To be Published
    Site MCSG
    PDB Id 2g7z Target Id APC80011
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5577,AAK34292, 160490 Molecular Weight 29950.02 Da.
    Residues 279 Isoelectric Point 6.99
    Sequence mgtikivtdssitiepelikalditvvplsvmidsklysdndlkeeghflslmkaskslpktsqppvgl faetyenlvkkgvtdivaihlspalsgtieasrqgaeiaeapvtvldsgftdqamkfqvveaakmakag aslneilaavqaiksktelyigvstlenlvkggrigrvtgvlssllnvkvvmalkndelktlvkgrgnk tftkwldsylaknshrpiaeiaisyageaslaltlkeriaayynhsisvletgsiiqthtgegafavmvrye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.20714
    Matthews' coefficent 2.89 Rfactor 0.16548
    Waters 461 Solvent Content 57.37

    Ligand Information
    Ligands HXA (DOCOSA-4,7,10,13,16,19-HEXAENOIC) x 2;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 2;GOL (GLYCEROL) x 3
    Metals ZN (ZINC) x 16;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2g7z
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Structure of a fatty acid-binding protein from Bacillus subtilis determined by sulfur-SAD phasing using in-house chromium radiation
    J Nan, Y Zhou, C Yang, E Brostromer - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch