.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g84

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of Cytidine and deoxycytidylate deaminase zinc-binding region from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2g84 Target Id APC5873
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4889,NP_840148.1, 228410 Molecular Weight 20226.95 Da.
    Residues 193 Isoelectric Point 5.04
    Sequence mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsglliaagtnrvv pgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgaviwsgvrslvcaarsddvea igfdegprpenwmggleargitvttgllrdaacallreynacngviynarcgvhk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.1604
    Matthews' coefficent 1.90 Rfactor 0.1283
    Waters 422 Solvent Content 35.12

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3;BME (BETA-MERCAPTOETHANOL) x 2
    Metals ZN (ZINC) x 2;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2g84
    1. Crystal structure of an ADP_ribosylated protein with a cytidine deaminase_like fold, but unknown function (TM1506), from Thermotoga maritima at 2.70 resolution
    Q Xu, P Kozbial, D McMullan - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch