.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g9i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an amide bond forming F(420):gamma-glutamyl ligase from Archaeoglobus fulgidus -- a member of a new family of non-ribosomal peptide synthases. J.Mol.Biol. 372 456-469 2007
    Site MCSG
    PDB Id 2g9i Target Id APC5730
    Related PDB Ids 2phn 
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4786,AAB89001.1, PF01996, 224325 Molecular Weight 27259.91 Da.
    Residues 249 Isoelectric Point 4.88
    Sequence mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpserakeiaari gkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslllppldpdgsaeklrrrile ltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrkdlygrelevtvecvadeiaafanllmg eggdgipavvvrglnvagegsmeeiyrseeedvirrclkrcl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.25484
    Matthews' coefficent 2.13 Rfactor 0.19021
    Waters 98 Solvent Content 42.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g9i
    1. Structure of an Amide Bond Forming F420:[gamma][gamma]-glutamyl Ligase from Archaeoglobus Fulgidus-A Member of a New Family of Non-ribosomal Peptide
    B Nocek, E Evdokimova, M Proudfoot - Journal of molecular , 2007 - Elsevier
     
    2. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    3. TA Binkowski, A Joachimiak - BMC structural biology, 2008 - BioMed Central Ltd
    30
     
    4. Cloning, expression, purification, crystallization and preliminary X-ray studies of the C-terminal domain of Rv3262 (FbiB) from Mycobacterium tuberculosis
    AM Rehan, G Bashiri, NG Paterson - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch