.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gk3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cytoplasmic Protein STM3548 from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 2gk3 Target Id APC24029
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5283,NP_462449, 99287 Molecular Weight 28557.10 Da.
    Residues 253 Isoelectric Point 4.88
    Sequence mnntqkklkvlfigeswhihmihskgydsftsskyeegatwlleclrkggvdidympahtvqiafpesi delnrydvivisdigsntfllqnetfyqlkikpnalesikeyvkngggllmiggylsfmgieakanykn tvlaevlpvimldgddrvekpegicaeavspehpvvngfsdypvflgynqavarddadvvltinndpll vfgeyqqgktacfmsdcsphwgtqqfmswpfytdlwvntlqfiark
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.25 Rfree 0.22643
    Matthews' coefficent 2.41 Rfactor 0.17717
    Waters 548 Solvent Content 49.06

    Ligand Information
    Ligands GOL (GLYCEROL) x 6
    Metals

    Jmol

     
    Google Scholar output for 2gk3
    1. Novel hexamerization motif is discovered in a conserved cytoplasmic protein from Salmonella typhimurium
    T Petrova, ME Cuff, R Wu, Y Kim, D Holzle - Journal of structural and , 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch