.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gkp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein NMB0488 from Neisseria meningitidis. To be Published
    Site MCSG
    PDB Id 2gkp Target Id APC83854
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5716,AAF40923.1, 122586 Molecular Weight 18843.22 Da.
    Residues 164 Isoelectric Point 5.17
    Sequence mtfnqeqdywagykaneraliiqtwsgfgryapdhlypphilpldtdnetlgttvlqalansrtfvyds pedqdffdtekirqryedwvaklcgnlgyktrralfknmmsvdiwlhngclkispsrhvkleawdaida ddvilsldnspeeigaglklalsrcr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.2065
    Matthews' coefficent 2.22 Rfactor 0.1541
    Waters 392 Solvent Content 44.66

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;BME (BETA-MERCAPTOETHANOL) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2gkp
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch